PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10024801m
Common NameCARUB_v10024801mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 353aa    MW: 39425.8 Da    PI: 5.3068
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10024801mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.4e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgrWT+eEd++l ++++  G g+W++ ++  g++R++k+c++rw +yl
  Carubv10024801m 14 RGRWTAEEDQILSNYIQSNGQGSWRSLPKNAGLKRCGKSCRLRWINYL 61
                     8*********************************************97 PP

2Myb_DNA-binding55.11.7e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ ++eE+el v+++  +G++ W++Ia++++ gRt++++k++w+++l
  Carubv10024801m  67 RGNISPEEEELVVKLHSTFGNR-WSLIASHLP-GRTDNEIKNYWNSHL 112
                      7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-21564IPR009057Homeodomain-like
PROSITE profilePS5129416.398961IPR017930Myb domain
SuperFamilySSF466892.9E-2811108IPR009057Homeodomain-like
SMARTSM007176.4E-121363IPR001005SANT/Myb domain
PfamPF002492.0E-141461IPR001005SANT/Myb domain
CDDcd001671.20E-81661No hitNo description
PROSITE profilePS5129426.17162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.2E-2665116IPR009057Homeodomain-like
SMARTSM007171.4E-1766114IPR001005SANT/Myb domain
PfamPF002491.2E-1567112IPR001005SANT/Myb domain
CDDcd001671.96E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009813Biological Processflavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MGRAPCCEKV GIKRGRWTAE EDQILSNYIQ SNGQGSWRSL PKNAGLKRCG KSCRLRWINY  60
LRSDLKRGNI SPEEEELVVK LHSTFGNRWS LIASHLPGRT DNEIKNYWNS HLSRKLHNFI  120
SKPSISRGII MNASSEPQAK RRLGRTSRSA MKPKTHRTKT RKTKKTPTRQ DPNADVAVAE  180
EGALMVALSG ADREAELGPC DYYGDFCCNK DLVSINGDSG VLSFDDDIAD LLLDESDPGY  240
VSCGGDDTRG FWSESSNQGK LDCLQSCPSV ESFLNYEHQV NDASADEYID WDCVWQEGSK  300
HDLWHQKEGA DSMVSWLLDG DDDAMIGKNN CDNFGEPLDH DDENALVAWL LS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-221211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0628641e-147AF062864.1 Arabidopsis thaliana putative transcription factor (MYB12) mRNA, complete cds.
GenBankAY0605881e-147AY060588.1 Arabidopsis thaliana At2g47460/T30B22.24 mRNA, complete cds.
GenBankAY1420671e-147AY142067.1 Arabidopsis thaliana At2g47460/T30B22.24 mRNA, complete cds.
GenBankAY5195801e-147AY519580.1 Arabidopsis thaliana MYB transcription factor (At2g47460) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006295685.10.0hypothetical protein CARUB_v10024801mg
SwissprotO222640.0MYB12_ARATH; Transcription factor MYB12
TrEMBLR0HWY80.0R0HWY8_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.4__2983__AT2G47460.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.10.0myb domain protein 12